PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01541.1_g00009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family ARF
Protein Properties Length: 638aa    MW: 72181.6 Da    PI: 6.5195
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01541.1_g00009.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B378.66.3e-25116217199
                              EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-E CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDf 79 
                              f kvlt sd++++g +++ +k+a+e+       +  ++ +++l+ ed +g +W++k+i+r++++r++lt+GW+ Fv a++L +gD+
  Rsa1.0_01541.1_g00009.1 116 FSKVLTASDTSTHGGFSVLRKHATEClppldmtQ--QTPTQELVAEDVHGYQWKFKHIFRGQPRRHLLTTGWSTFVTAKRLVAGDT 199
                              88****************************9643..445569******************************************** PP

                              EEEEE-SSSEE..EEEEE-S CS
                       B3  80 vvFkldgrsefelvvkvfrk 99 
                              +vF   + +++el+v+v+r+
  Rsa1.0_01541.1_g00009.1 200 FVFL--RGENGELRVGVRRA 217
                              ****..449999******97 PP

2Auxin_resp1102.5e-36242321183
               Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                              a ha++tks+F+v+Y+Pr+  s+F+++++k+++++++k+svGmRfkm+fe+eds+err+sGtvvgv+d+++ +W++S+Wr L+
  Rsa1.0_01541.1_g00009.1 242 ACHATQTKSMFTVYYKPRT--SQFIISLNKYLESMNNKFSVGMRFKMRFEGEDSPERRYSGTVVGVKDCST-HWKDSNWRRLE 321
                              689***************6..9**********************************************777.********985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.106.1E-43108231IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.83E-37110245IPR015300DNA-binding pseudobarrel domain
CDDcd100171.58E-21114216No hitNo description
PROSITE profilePS5086312.788116218IPR003340B3 DNA binding domain
SMARTSM010191.3E-24116218IPR003340B3 DNA binding domain
PfamPF023621.2E-22116217IPR003340B3 DNA binding domain
PfamPF065071.0E-32242320IPR010525Auxin response factor
PfamPF023094.7E-8503558IPR033389AUX/IAA domain
SuperFamilySSF542779.16E-13516598No hitNo description
PROSITE profilePS5174525.719522614IPR000270PB1 domain
PfamPF023091.8E-6565610IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 638 aa     Download sequence    Send to blast
MTTTGEHMYG ELWKLCAGPV VDVPQAEERV FYFPQGHMEQ LEASTEQDLN AVKPTKPLFD  60
LPPKILCRVM DVRLQAEKDT DEVYAQIMLM PEETVDEPMS PDLPPPESHR PKVHSFSKVL  120
TASDTSTHGG FSVLRKHATE CLPPLDMTQQ TPTQELVAED VHGYQWKFKH IFRGQPRRHL  180
LTTGWSTFVT AKRLVAGDTF VFLRGENGEL RVGVRRANRQ QINMPSSVIS SHSMHLGVLA  240
TACHATQTKS MFTVYYKPRT SQFIISLNKY LESMNNKFSV GMRFKMRFEG EDSPERRYSG  300
TVVGVKDCST HWKDSNWRRL EVHWDEPASI SRPDKVSPWE IEPFVSSENV SQSVMPKNKR  360
PRHFSEVSAL GKTASNLWSS ALAQSHELAQ SCITSQRNPP QQCYRDATED AKKSDWPISP  420
YSASNLSRNT TLNDQMIFPV EQKKPETTTA SYRLFGVDLL SSSVPAPEEK AALMQPINIT  480
KPAPDSNSDP KSEVSKLSEE KKQEPAQASS KEVQSKENSS TRSRTKVQMQ GVPVGRAVDL  540
TVLNGYSELI DDLEKLFDIE GELKSRNQWE IVFTDDEGDM MLVGDDPWPE FCNMVKRIFI  600
WSKEEVKKMT PGNQLRKLLT EVDTALTTTI SKTENLSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1631134622357Auxin response factor 1
4ldw_A1e-1631134622357Auxin response factor 1
4ldw_B1e-1631134622357Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794740.0JN979474.1 Brassica rapa subsp. pekinensis auxin response factor 9 (ARF9-2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013737711.10.0PREDICTED: auxin response factor 9-like
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLH9B4D50.0H9B4D5_BRARP; Auxin response factor
STRINGBra019255.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.20.0auxin response factor 9